Class b: All beta proteins [48724] (119 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains |
Protein Riboflavin synthase [63784] (2 species) trimerises via the additional C-terminal helix |
Species Escherichia coli [TaxId:562] [63785] (3 PDB entries) |
Domain d1i8dc1: 1i8d C:1-90 [61957] |
PDB Entry: 1i8d (more details), 2 Å
SCOP Domain Sequences for d1i8dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8dc1 b.43.4.3 (C:1-90) Riboflavin synthase {Escherichia coli} mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs fdlmketlritnlgdlkvgdwvnveraakf
Timeline for d1i8dc1:
View in 3D Domains from other chains: (mouse over for more information) d1i8da1, d1i8da2, d1i8db1, d1i8db2 |