Lineage for d1i84z_ (1i84 Z:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1071601Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 1071602Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 1071603Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 1071939Protein Heavy meromyosin subfragment [64619] (1 species)
  7. 1071940Species Chicken (Gallus gallus) [TaxId:9031] [64620] (1 PDB entry)
  8. 1071946Domain d1i84z_: 1i84 Z: [61945]
    Cryo-EM structure

Details for d1i84z_

PDB Entry: 1i84 (more details), 20 Å

PDB Description: cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. only c alphas provided for regulatory light chain. only backbone atoms provided for s2 fragment.
PDB Compounds: (Z:) smooth muscle myosin regulatory light chain

SCOPe Domain Sequences for d1i84z_:

Sequence, based on SEQRES records: (download)

>d1i84z_ i.15.1.1 (Z:) Heavy meromyosin subfragment {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Sequence, based on observed residues (ATOM records): (download)

>d1i84z_ i.15.1.1 (Z:) Heavy meromyosin subfragment {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
fpvdyknicyvithgeda

SCOPe Domain Coordinates for d1i84z_:

Click to download the PDB-style file with coordinates for d1i84z_.
(The format of our PDB-style files is described here.)

Timeline for d1i84z_: