SCOPe 2.01: Domain d1i84u_: 1i84 U:

Lineage for d1i84u_ (1i84 U:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.15: Muscle protein complexes [64616] (1 superfamily)

4. Superfamily i.15.1: Muscle protein complexes [64617] (1 family)

5. Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)

6. Protein Heavy meromyosin subfragment [64619] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [64620] (1 PDB entry)

8. Domain d1i84u_: 1i84 U: [61942]
   Cryo-EM structure

Details for d1i84u_

PDB Entry: 1i84, 20 Å

PDB Description: cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. only c alphas provided for regulatory light chain. only backbone atoms provided for s2 fragment.

PDB Compounds: (U:) smooth muscle myosin regulatory light chain

SCOPe Domain Sequences for d1i84u_:

Sequence, based on SEQRES records:

>d1i84u_ i.15.1.1 (U:) Heavy meromyosin subfragment {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Sequence, based on observed residues (ATOM records):

>d1i84u_ i.15.1.1 (U:) Heavy meromyosin subfragment {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
fpvdyknicyvithgeda

Timeline for d1i84u_:

• d1i84u_ first appeared in SCOP 1.57
  
• d1i84u_ appears in SCOP 1.75
  
• d1i84u_ appears in SCOPe 2.02
  
• d1i84u_ appears in the current release, SCOPe 2.08