Lineage for d1i81f_ (1i81 F:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166075Fold b.38: Sm-like fold [50181] (2 superfamilies)
  4. 166076Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) (S)
  5. 166077Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 166078Protein Archaeal homoheptameric Sm protein [63758] (4 species)
  7. 166124Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries)
  8. 166130Domain d1i81f_: 1i81 F: [61935]

Details for d1i81f_

PDB Entry: 1i81 (more details), 2 Å

PDB Description: crystal structure of a heptameric lsm protein from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1i81f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i81f_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisp

SCOP Domain Coordinates for d1i81f_:

Click to download the PDB-style file with coordinates for d1i81f_.
(The format of our PDB-style files is described here.)

Timeline for d1i81f_: