| Class b: All beta proteins [48724] (111 folds) |
| Fold b.38: Sm-like fold [50181] (2 superfamilies) |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
| Protein Archaeal homoheptameric Sm protein [63758] (4 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries) |
| Domain d1i81e_: 1i81 E: [61934] |
PDB Entry: 1i81 (more details), 2 Å
SCOP Domain Sequences for d1i81e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i81e_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisp
Timeline for d1i81e_: