![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.107: DHH phosphoesterases [64181] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456 Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest |
![]() | Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) ![]() constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains |
![]() | Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins) |
![]() | Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [64185] (1 PDB entry) |
![]() | Domain d1i74a_: 1i74 A: [61867] CASP4 complexed with mg, mn, so4 |
PDB Entry: 1i74 (more details), 2.2 Å
SCOPe Domain Sequences for d1i74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i74a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Streptococcus mutans [TaxId: 1309]} skilvfghqnpdsdaigssmayaylkrqlgvdaqavalgnpneetafvldyfgiqappvv ksaqaegakqviltdhnefqqsiadirevevvevvdhhrvanfetanplymrlepvgsas sivyrlykengvaipkeiagvmlsglisdtlllksptthasdpavaedlakiagvdlqey glamlkagtnlasktaaqlvdidaktfelngsqvrvaqvntvdinevlerqneieeaika sqaangysdfvlmitdilnsnseilalgnntdkveaafnftlknnhaflagavsrkkqvv pqltesfng
Timeline for d1i74a_: