Lineage for d1i74a_ (1i74 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.107: Manganese-dependent inorganic pyrophosphatase [64181] (1 superfamily) Superfamily c.107.1: Manganese-dependent inorganic pyrophosphatase [64182] (1 family) 
Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase [64183] (1 protein) Protein Manganese-dependent inorganic pyrophosphatase [64184] (1 species) Species Streptococcus mutans [TaxId:1309] [64185] (1 PDB entry) 
Domain d1i74a_: 1i74 A: [61867]
Details for d1i74a_
PDB Entry: 1i74 (more details), 2.2 Å
PDB Description: streptococcus mutans inorganic pyrophosphatase
SCOP Domain Sequences for d1i74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i74a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase {Streptococcus mutans}
skilvfghqnpdsdaigssmayaylkrqlgvdaqavalgnpneetafvldyfgiqappvv
ksaqaegakqviltdhnefqqsiadirevevvevvdhhrvanfetanplymrlepvgsas
sivyrlykengvaipkeiagvmlsglisdtlllksptthasdpavaedlakiagvdlqey
glamlkagtnlasktaaqlvdidaktfelngsqvrvaqvntvdinevlerqneieeaika
sqaangysdfvlmitdilnsnseilalgnntdkveaafnftlknnhaflagavsrkkqvv
pqltesfng
SCOP Domain Coordinates for d1i74a_:
Click to download the PDB-style file with coordinates for d1i74a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i74a_:
- d1i74a_ is new in SCOP 1.57
- d1i74a_ appears in SCOP 1.59
- d1i74a_ appears in the current release, SCOPe 2.08
View in 3D
