| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (2 species) |
| Species Thermus aquaticus [TaxId:271] [63565] (1 PDB entry) |
| Domain d1i6ve_: 1i6v E: [61858] Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vc_, d1i6vd_ complexed with mg, rfp, zn |
PDB Entry: 1i6v (more details), 3.3 Å
SCOP Domain Sequences for d1i6ve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6ve_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee
Timeline for d1i6ve_: