Lineage for d1i6ve_ (1i6v E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545177Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 545178Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 545179Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
    4 helices; irregular array
  6. 545180Protein RNA polymerase omega subunit [63564] (2 species)
  7. 545181Species Thermus aquaticus [TaxId:271] [63565] (1 PDB entry)
  8. 545182Domain d1i6ve_: 1i6v E: [61858]
    Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vc_, d1i6vd_
    complexed with mg, rfp, zn

Details for d1i6ve_

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ve_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee

SCOP Domain Coordinates for d1i6ve_:

Click to download the PDB-style file with coordinates for d1i6ve_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ve_: