| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus aquaticus [TaxId:271] [64314] (1 PDB entry) |
| Domain d1i6va1: 1i6v A:6-49,A:173-229 [61852] Other proteins in same PDB: d1i6va2, d1i6vb2, d1i6vc_, d1i6vd_, d1i6ve_ |
PDB Entry: 1i6v (more details), 3.3 Å
SCOP Domain Sequences for d1i6va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6va1 d.74.3.1 (A:6-49,A:173-229) RNA polymerase alpha {Thermus aquaticus}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
Timeline for d1i6va1: