Lineage for d1i6ve_ (1i6v E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51607Fold a.143: RNA polymerase omega subunit [63561] (1 superfamily)
  4. 51608Superfamily a.143.1: RNA polymerase omega subunit [63562] (1 family) (S)
  5. 51609Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
  6. 51610Protein RNA polymerase omega subunit [63564] (1 species)
  7. 51611Species Thermus aquaticus [TaxId:271] [63565] (1 PDB entry)
  8. 51612Domain d1i6ve_: 1i6v E: [61858]
    Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vc_, d1i6vd_

Details for d1i6ve_

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex
PDB Compounds: (E:)

SCOP Domain Sequences for d1i6ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ve_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee

SCOP Domain Coordinates for d1i6ve_:

Click to download the PDB-style file with coordinates for d1i6ve_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ve_: