Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein MMLV reverse transcriptase [56687] (1 species) |
Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries) Uniprot P03355 RE 144-594 |
Domain d1i6ja_: 1i6j A: [61845] fragment of "palm" and "fingers" domains protein/DNA complex |
PDB Entry: 1i6j (more details), 2 Å
SCOPe Domain Sequences for d1i6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6ja_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} mtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrll dqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpps hqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdea lhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqic qkqvkylgyllkegqr
Timeline for d1i6ja_: