Lineage for d1i6ja_ (1i6j A:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884437Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 884660Protein MMLV reverse transcriptase [56687] (1 species)
  7. 884661Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 884666Domain d1i6ja_: 1i6j A: [61845]
    fragment of "palm" and "fingers" domains

Details for d1i6ja_

PDB Entry: 1i6j (more details), 2 Å

PDB Description: crystal structure of a pseudo-16-mer dna with stacked guanines and two g-a mispairs complexed with the n-terminal fragment of moloney murine leukemia virus reverse transcriptase
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1i6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ja_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
mtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrll
dqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpps
hqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdea
lhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqic
qkqvkylgyllkegqr

SCOP Domain Coordinates for d1i6ja_:

Click to download the PDB-style file with coordinates for d1i6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ja_: