SCOP 1.63: Domain d1i6hc1: 1i6h C:3-41,C:173-268

Lineage for d1i6hc1 (1i6h C:3-41,C:173-268)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (4 PDB entries)

8. Domain d1i6hc1: 1i6h C:3-41,C:173-268 [61833]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
   complexed with mg, zn

Details for d1i6hc1

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hc1:

Sequence; same for both SEQRES and ATOM records:

>d1i6hc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae)}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d1i6hc1:

• d1i6hc1 first appeared in SCOP 1.57
  
• d1i6hc1 appears in SCOP 1.61
  
• d1i6hc1 appears in SCOP 1.65
  
• d1i6hc1 appears in the current release, SCOPe 2.08