![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein) |
![]() | Protein Chemotaxis protein CheA P1 domain [63513] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry) |
![]() | Domain d1i5nc_: 1i5n C: [61807] |
PDB Entry: 1i5n (more details), 2.14 Å
SCOP Domain Sequences for d1i5nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5nc_ a.24.10.3 (C:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 602]} isdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilqe tthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnalr qlale
Timeline for d1i5nc_: