Lineage for d1i5nc_ (1i5n C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638124Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 638162Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)
  6. 638163Protein Chemotaxis protein CheA P1 domain [63513] (2 species)
  7. 638164Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)
  8. 638167Domain d1i5nc_: 1i5n C: [61807]

Details for d1i5nc_

PDB Entry: 1i5n (more details), 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium
PDB Compounds: (C:) chemotaxis protein chea

SCOP Domain Sequences for d1i5nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5nc_ a.24.10.3 (C:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium [TaxId: 602]}
isdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilqe
tthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnalr
qlale

SCOP Domain Coordinates for d1i5nc_:

Click to download the PDB-style file with coordinates for d1i5nc_.
(The format of our PDB-style files is described here.)

Timeline for d1i5nc_: