SCOP 1.57: Domain d1i5nc_: 1i5n C:

Lineage for d1i5nc_ (1i5n C:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families)

5. Family a.24.10.3: Chemotaxis protein CheA P1 domain [63512] (1 protein)

6. Protein Chemotaxis protein CheA P1 domain [63513] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [63514] (1 PDB entry)

8. Domain d1i5nc_: 1i5n C: [61807]

Details for d1i5nc_

PDB Entry: 1i5n, 2.14 Å

PDB Description: Crystal structure of the P1 domain of CheA from Salmonella typhimurium

SCOP Domain Sequences for d1i5nc_:

Sequence; same for both SEQRES and ATOM records:

>d1i5nc_ a.24.10.3 (C:) Chemotaxis protein CheA P1 domain {Salmonella typhimurium}
isdfyqtffdeadelladmeqhlldlvpespdaeqlnaifraahsikggagtfgftilqe
tthlmenlldearrgemqlntdiinlfletkdimqeqldayknseepdaasfeyicnalr
qlale

Timeline for d1i5nc_:

• d1i5nc_ is new in SCOP 1.57
  
• d1i5nc_ appears in SCOP 1.59
  
• d1i5nc_ appears in the current release, SCOPe 2.08