| Class b: All beta proteins [48724] (119 folds) |
| Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (6 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (5 species) |
| Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries) |
| Domain d1i5lb_: 1i5l B: [61792] |
PDB Entry: 1i5l (more details), 2.75 Å
SCOP Domain Sequences for d1i5lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5lb_ b.38.1.1 (B:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspapg
Timeline for d1i5lb_: