Class b: All beta proteins [48724] (174 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (1 family) |
Family b.72.1.1: WW domain [51046] (12 proteins) |
Protein Ubiquitin ligase NEDD4 WWIII domain [63837] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [63838] (2 PDB entries) |
Domain d1i5hw_: 1i5h W: [61785] complexed to renac bp2 peptide |
PDB Entry: 1i5h (more details)
SCOPe Domain Sequences for d1i5hw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} gspvdsndlgplppgweerthtdgrvffinhnikktqwedprmqnvaitg
Timeline for d1i5hw_: