Lineage for d1i5hw_ (1i5h W:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961395Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 961396Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 961397Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 961451Protein Ubiquitin ligase NEDD4 WWIII domain [63837] (2 species)
  7. 961454Species Norway rat (Rattus norvegicus) [TaxId:10116] [63838] (2 PDB entries)
  8. 961456Domain d1i5hw_: 1i5h W: [61785]
    complexed to renac bp2 peptide

Details for d1i5hw_

PDB Entry: 1i5h (more details)

PDB Description: solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex
PDB Compounds: (W:) ubiquitin ligase nedd4

SCOPe Domain Sequences for d1i5hw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gspvdsndlgplppgweerthtdgrvffinhnikktqwedprmqnvaitg

SCOPe Domain Coordinates for d1i5hw_:

Click to download the PDB-style file with coordinates for d1i5hw_.
(The format of our PDB-style files is described here.)

Timeline for d1i5hw_: