Lineage for d1i5hw_ (1i5h W:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63149Fold b.72: WW domain-like [51044] (2 superfamilies)
  4. 63150Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 63151Family b.72.1.1: WW domain [51046] (5 proteins)
  6. 63169Protein Ubiquitin ligase NEDD4 WWIII domain [63837] (1 species)
  7. 63170Species Rat (Rattus norvegicus) [TaxId:10116] [63838] (1 PDB entry)
  8. 63171Domain d1i5hw_: 1i5h W: [61785]

Details for d1i5hw_

PDB Entry: 1i5h (more details)

PDB Description: solution structure of the rnedd4 wwiii domain-renal bp2 peptide complex

SCOP Domain Sequences for d1i5hw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus)}
gspvdsndlgplppgweerthtdgrvffinhnikktqwedprmqnvaitg

SCOP Domain Coordinates for d1i5hw_:

Click to download the PDB-style file with coordinates for d1i5hw_.
(The format of our PDB-style files is described here.)

Timeline for d1i5hw_: