Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) |
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) |
Domain d1i50e1: 1i50 E:1-143 [61758] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_ complexed with mn, zn |
PDB Entry: 1i50 (more details), 2.8 Å
SCOP Domain Sequences for d1i50e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50e1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa mklvpsippatietfneaalvvn
Timeline for d1i50e1: