Lineage for d1i50f_ (1i50 F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649980Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 649981Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 650007Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 650008Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 650009Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)
  8. 650011Domain d1i50f_: 1i50 F: [61760]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    complexed with mn, zn

Details for d1i50f_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (F:) DNA-directed RNA polymerase II 23kd polypeptide

SCOP Domain Sequences for d1i50f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50f_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1i50f_:

Click to download the PDB-style file with coordinates for d1i50f_.
(The format of our PDB-style files is described here.)

Timeline for d1i50f_: