![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) |
![]() | Domain d1i50i1: 1i50 I:1-49 [61762] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50j_, d1i50k_, d1i50l_ |
PDB Entry: 1i50 (more details), 2.8 Å
SCOP Domain Sequences for d1i50i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50i1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1i50i1: