Lineage for d1i4ks_ (1i4k S:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109944Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 109945Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 109946Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 109947Protein Archaeal homoheptameric Sm protein [63758] (3 species)
  7. 109948Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries)
  8. 109969Domain d1i4ks_: 1i4k S: [61710]

Details for d1i4ks_

PDB Entry: 1i4k (more details), 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution

SCOP Domain Sequences for d1i4ks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ks_ b.38.1.1 (S:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa

SCOP Domain Coordinates for d1i4ks_:

Click to download the PDB-style file with coordinates for d1i4ks_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ks_: