Class b: All beta proteins [48724] (104 folds) |
Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries) |
Domain d1i4ks_: 1i4k S: [61710] |
PDB Entry: 1i4k (more details), 2.5 Å
SCOP Domain Sequences for d1i4ks_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4ks_ b.38.1.1 (S:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus} prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi rgdtvvfvspa
Timeline for d1i4ks_:
View in 3D Domains from other chains: (mouse over for more information) d1i4k1_, d1i4k2_, d1i4ka_, d1i4kb_, d1i4kc_, d1i4kd_, d1i4ke_, d1i4kf_, d1i4kg_, d1i4kh_, d1i4ki_, d1i4kj_, d1i4kk_, d1i4kl_, d1i4km_, d1i4kn_, d1i4ko_, d1i4kp_, d1i4kq_, d1i4kr_, d1i4kt_, d1i4ku_, d1i4kv_, d1i4kw_, d1i4kx_, d1i4ky_, d1i4kz_ |