SCOP 1.57: Domain d1i4ks_: 1i4k S:

Lineage for d1i4ks_ (1i4k S:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)

4. Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein Archaeal homoheptameric Sm protein [63758] (3 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries)

8. Domain d1i4ks_: 1i4k S: [61710]

Details for d1i4ks_

PDB Entry: 1i4k, 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution

SCOP Domain Sequences for d1i4ks_:

Sequence; same for both SEQRES and ATOM records:

>d1i4ks_ b.38.1.1 (S:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa

Timeline for d1i4ks_:

• d1i4ks_ is new in SCOP 1.57
  
• d1i4ks_ appears in SCOP 1.59
  
• d1i4ks_ appears in the current release, SCOPe 2.08