Lineage for d1i4kd_ (1i4k D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228326Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 228327Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 228328Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (6 proteins)
    forms homo and heteroheptameric ring structures
  6. 228329Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 228330Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 228336Domain d1i4kd_: 1i4k D: [61695]

Details for d1i4kd_

PDB Entry: 1i4k (more details), 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution

SCOP Domain Sequences for d1i4kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4kd_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1}
pprpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvv
irgdtvvfvspa

SCOP Domain Coordinates for d1i4kd_:

Click to download the PDB-style file with coordinates for d1i4kd_.
(The format of our PDB-style files is described here.)

Timeline for d1i4kd_: