Class a: All alpha proteins [46456] (171 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (4 PDB entries) |
Domain d1i3qj_: 1i3q J: [61617] Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qk_, d1i3ql_ complexed with mg, zn |
PDB Entry: 1i3q (more details), 3.1 Å
SCOP Domain Sequences for d1i3qj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3qj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d1i3qj_: