SCOP 1.65: Domain d1i3qj_: 1i3q J:

Lineage for d1i3qj_ (1i3q J:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (4 PDB entries)

8. Domain d1i3qj_: 1i3q J: [61617]
   Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qk_, d1i3ql_
   complexed with mg, zn

Details for d1i3qj_

PDB Entry: 1i3q, 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution

SCOP Domain Sequences for d1i3qj_:

Sequence; same for both SEQRES and ATOM records:

>d1i3qj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1i3qj_:

• d1i3qj_ first appeared in SCOP 1.57
  
• d1i3qj_ appears in SCOP 1.63
  
• d1i3qj_ appears in SCOP 1.67
  
• d1i3qj_ appears in the current release, SCOPe 2.08