Lineage for d1i3of_ (1i3o F:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067331Protein BIR domains of XIAP [57928] (1 species)
  7. 1067332Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries)
    Uniprot P98170 241-356
  8. 1067354Domain d1i3of_: 1i3o F: [61606]
    Other proteins in same PDB: d1i3o.1, d1i3o.2
    BIR2 domain complexed to caspase 3
    complexed with zn

Details for d1i3of_

PDB Entry: 1i3o (more details), 2.7 Å

PDB Description: crystal structure of the complex of xiap-bir2 and caspase 3
PDB Compounds: (F:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1i3of_:

Sequence, based on SEQRES records: (download)

>d1i3of_ g.52.1.1 (F:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
thadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltprelasaglyytgi
gdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnln

Sequence, based on observed residues (ATOM records): (download)

>d1i3of_ g.52.1.1 (F:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
thadyllrtgqvvdisdtiyprnpamyseearlksltprelasaglyytgigdqvqcfac
ggklknwepgdrawsehrrhfpncffvlgrnln

SCOPe Domain Coordinates for d1i3of_:

Click to download the PDB-style file with coordinates for d1i3of_.
(The format of our PDB-style files is described here.)

Timeline for d1i3of_: