SCOPe 2.01: Domain d1i3o.1: 1i3o A:,B:

Lineage for d1i3o.1 (1i3o A:,B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Apopain (caspase-3, cpp32) [52131] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52132] (24 PDB entries)

8. Domain d1i3o.1: 1i3o A:,B: [61603]
   Other proteins in same PDB: d1i3oe_, d1i3of_
   complexed to xiap-bir2
   complexed with zn

Details for d1i3o.1

PDB Entry: 1i3o, 2.7 Å

PDB Description: crystal structure of the complex of xiap-bir2 and caspase 3

PDB Compounds: (A:) caspase 3, (B:) caspase 3

SCOPe Domain Sequences for d1i3o.1:

Sequence; same for both SEQRES and ATOM records:

>g1i3o.1 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
sldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndl
treeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsl
tgkpklfiiqaargteldcgietXsgvdddmachkipveadflyaystapgyyswrnskd
gswfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltk
elyfy

Timeline for d1i3o.1:

• d1i3o.1 first appeared in SCOP 1.57
  
• d1i3o.1 appears in SCOP 1.75
  
• d1i3o.1 appears in SCOPe 2.02
  
• d1i3o.1 appears in the current release, SCOPe 2.08