Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
Protein Apopain (caspase-3, cpp32) [52131] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52132] (24 PDB entries) |
Domain d1i3o.1: 1i3o A:,B: [61603] Other proteins in same PDB: d1i3oe_, d1i3of_ complexed to xiap-bir2 complexed with zn |
PDB Entry: 1i3o (more details), 2.7 Å
SCOPe Domain Sequences for d1i3o.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1i3o.1 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]} sldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndl treeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsl tgkpklfiiqaargteldcgietXsgvdddmachkipveadflyaystapgyyswrnskd gswfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltk elyfy
Timeline for d1i3o.1: