Lineage for d1i1rb_ (1i1r B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 46944Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 46982Protein Interleukin-6 [47272] (2 species)
  7. 46987Species Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId:37296] [63528] (1 PDB entry)
  8. 46988Domain d1i1rb_: 1i1r B: [61548]
    Other proteins in same PDB: d1i1ra1, d1i1ra2, d1i1ra3

Details for d1i1rb_

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1rb_ a.26.1.1 (B:) Interleukin-6 {Human herpesvirus 8, Kaposi's sarcoma herpes-virus}
efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip

SCOP Domain Coordinates for d1i1rb_:

Click to download the PDB-style file with coordinates for d1i1rb_.
(The format of our PDB-style files is described here.)

Timeline for d1i1rb_: