SCOP 1.57: Domain d1i1rb_: 1i1r B:

Lineage for d1i1rb_ (1i1r B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId:37296] [63528] (1 PDB entry)

8. Domain d1i1rb_: 1i1r B: [61548]
   Other proteins in same PDB: d1i1ra1, d1i1ra2, d1i1ra3

Details for d1i1rb_

PDB Entry: 1i1r, 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1rb_:

Sequence; same for both SEQRES and ATOM records:

>d1i1rb_ a.26.1.1 (B:) Interleukin-6 {Human herpesvirus 8, Kaposi's sarcoma herpes-virus}
efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip

Timeline for d1i1rb_:

• d1i1rb_ is new in SCOP 1.57
  
• d1i1rb_ appears in SCOP 1.59
  
• d1i1rb_ appears in the current release, SCOPe 2.08