Lineage for d1i1ra2 (1i1r A:102-196)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54743Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 54744Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries)
  8. 54750Domain d1i1ra2: 1i1r A:102-196 [61546]
    Other proteins in same PDB: d1i1rb_

Details for d1i1ra2

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ra2 b.1.2.1 (A:102-196) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
lppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsct
vdystvyfvnievwveaenalgkvtsdhinfdpvy

SCOP Domain Coordinates for d1i1ra2:

Click to download the PDB-style file with coordinates for d1i1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ra2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1rb_