SCOP 1.57: Domain d1i1ra3: 1i1r A:197-302

Lineage for d1i1ra3 (1i1r A:197-302)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries)

8. Domain d1i1ra3: 1i1r A:197-302 [61547]
   Other proteins in same PDB: d1i1rb_

Details for d1i1ra3

PDB Entry: 1i1r, 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1ra3:

Sequence; same for both SEQRES and ATOM records:

>d1i1ra3 b.1.2.1 (A:197-302) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta
strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityed

Timeline for d1i1ra3:

• d1i1ra3 is new in SCOP 1.57
  
• d1i1ra3 appears in SCOP 1.59
  
• d1i1ra3 appears in the current release, SCOPe 2.08