Lineage for d1i1ra2 (1i1r A:102-196)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1109778Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1109779Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1109820Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 1109821Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 1109827Domain d1i1ra2: 1i1r A:102-196 [61546]
    Other proteins in same PDB: d1i1rb_
    complexed with a cytokine

Details for d1i1ra2

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex
PDB Compounds: (A:) interleukin-6 receptor beta chain

SCOPe Domain Sequences for d1i1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ra2 b.1.2.1 (A:102-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
lppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsct
vdystvyfvnievwveaenalgkvtsdhinfdpvy

SCOPe Domain Coordinates for d1i1ra2:

Click to download the PDB-style file with coordinates for d1i1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ra2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1rb_