SCOP 1.63: Domain d1i1qb_: 1i1q B:

Lineage for d1i1qb_ (1i1q B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [63969] (1 PDB entry)

8. Domain d1i1qb_: 1i1q B: [61544]
   Other proteins in same PDB: d1i1qa_
   complexed with trp

Details for d1i1qb_

PDB Entry: 1i1q, 1.9 Å

PDB Description: structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium

SCOP Domain Sequences for d1i1qb_:

Sequence, based on SEQRES records:

>d1i1qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Salmonella typhimurium}
adillldnidsftwnladqlrtnghnvviyrnhipaqtlidrlatmknpvlmlspgpgvp
seagcmpelltrlrgklpiigiclghqaiveayggyvgqageilhgkatsiehdgqamfa
glanplpvaryhslvgsnvpagltinahfngmvmavrhdadrvcgfqfhpesilttqgar
lleqtlawaqqk

Sequence, based on observed residues (ATOM records):

>d1i1qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Salmonella typhimurium}
adillldnidsftwnladqlrtnghnvviyrnhipaqtlidrlatmknpvlmlspgpgvp
seagcmpelltrlrgklpiigiclghqaiveayggyvgqilhgkatsiehdgqamfagla
nplpvaryhssnvpagltinahfngmvmavrhdadrvcgfqfhpesilttqgarlleqtl
awaqqk

Timeline for d1i1qb_:

• d1i1qb_ first appeared in SCOP 1.57
  
• d1i1qb_ appears in SCOP 1.61
  
• d1i1qb_ appears in SCOP 1.65
  
• d1i1qb_ appears in the current release, SCOPe 2.08