Lineage for d1i1qb_ (1i1q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104320Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species)
  7. 2104321Species Salmonella typhimurium [TaxId:90371] [63969] (1 PDB entry)
  8. 2104322Domain d1i1qb_: 1i1q B: [61544]
    Other proteins in same PDB: d1i1qa_
    complexed with trp

Details for d1i1qb_

PDB Entry: 1i1q (more details), 1.9 Å

PDB Description: structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium
PDB Compounds: (B:) anthranilate synthase component II

SCOPe Domain Sequences for d1i1qb_:

Sequence, based on SEQRES records: (download)

>d1i1qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Salmonella typhimurium [TaxId: 90371]}
adillldnidsftwnladqlrtnghnvviyrnhipaqtlidrlatmknpvlmlspgpgvp
seagcmpelltrlrgklpiigiclghqaiveayggyvgqageilhgkatsiehdgqamfa
glanplpvaryhslvgsnvpagltinahfngmvmavrhdadrvcgfqfhpesilttqgar
lleqtlawaqqk

Sequence, based on observed residues (ATOM records): (download)

>d1i1qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Salmonella typhimurium [TaxId: 90371]}
adillldnidsftwnladqlrtnghnvviyrnhipaqtlidrlatmknpvlmlspgpgvp
seagcmpelltrlrgklpiigiclghqaiveayggyvgqilhgkatsiehdgqamfagla
nplpvaryhssnvpagltinahfngmvmavrhdadrvcgfqfhpesilttqgarlleqtl
awaqqk

SCOPe Domain Coordinates for d1i1qb_:

Click to download the PDB-style file with coordinates for d1i1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1i1qb_: