Lineage for d1i0cb_ (1i0c B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227651Protein EPS8 SH3 domain [50082] (1 species)
  7. 227652Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries)
  8. 227656Domain d1i0cb_: 1i0c B: [61486]

Details for d1i0cb_

PDB Entry: 1i0c (more details), 2 Å

PDB Description: eps8 sh3 closed monomer

SCOP Domain Sequences for d1i0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0cb_ b.34.2.1 (B:) EPS8 SH3 domain {Mouse (Mus musculus)}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrt

SCOP Domain Coordinates for d1i0cb_:

Click to download the PDB-style file with coordinates for d1i0cb_.
(The format of our PDB-style files is described here.)

Timeline for d1i0cb_:

227656
d1i0cb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1i0ca_