SCOP 1.59: Domain d1hzzb1: 1hzz B:144-326

Lineage for d1hzzb1 (1hzz B:144-326)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (9 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (2 PDB entries)

8. Domain d1hzzb1: 1hzz B:144-326 [61472]
   Other proteins in same PDB: d1hzza2, d1hzzb2, d1hzzc_

Details for d1hzzb1

PDB Entry: 1hzz, 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzb1:

Sequence, based on SEQRES records:

>d1hzzb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d1hzzb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamefrkkqaeavlkelvktdiaittalipgkpapvlite
emvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d1hzzb1:

• d1hzzb1 first appeared in SCOP 1.57
  
• d1hzzb1 appears in SCOP 1.61
  
• d1hzzb1 appears in the current release, SCOPe 2.08