Lineage for d1hzzb1 (1hzz B:144-326)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66721Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (9 protein domains)
  6. 66744Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
  7. 66745Species Rhodospirillum rubrum [TaxId:1085] [63938] (2 PDB entries)
  8. 66751Domain d1hzzb1: 1hzz B:144-326 [61472]
    Other proteins in same PDB: d1hzza2, d1hzzb2, d1hzzc_

Details for d1hzzb1

PDB Entry: 1hzz (more details), 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzb1:

Sequence, based on SEQRES records: (download)

>d1hzzb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1hzzb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamefrkkqaeavlkelvktdiaittalipgkpapvlite
emvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOP Domain Coordinates for d1hzzb1:

Click to download the PDB-style file with coordinates for d1hzzb1.
(The format of our PDB-style files is described here.)

Timeline for d1hzzb1: