SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1hzeb_ (1hze B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054818Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
    automatically mapped to Pfam PF00677
  6. 2054819Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 2054820Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
    Uniprot P29015 1-87
  8. 2054830Domain d1hzeb_: 1hze B: [61435]
    N-terminal domain only
    complexed with rbf

Details for d1hzeb_

PDB Entry: 1hze (more details)

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
PDB Compounds: (B:) riboflavin synthase alpha chain

SCOPe Domain Sequences for d1hzeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzeb_ b.43.4.3 (B:) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

SCOPe Domain Coordinates for d1hzeb_:

Click to download the PDB-style file with coordinates for d1hzeb_.
(The format of our PDB-style files is described here.)

Timeline for d1hzeb_: