SCOPe 2.08: Domain d1hzea_: 1hze A:

Lineage for d1hzea_ (1hze A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains
   automatically mapped to Pfam PF00677

6. Protein Riboflavin synthase [63784] (2 species)
   trimerizes via the additional C-terminal helix

7. Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
   Uniprot P29015 1-87

8. Domain d1hzea_: 1hze A: [61434]
   N-terminal domain only
   complexed with rbf

Details for d1hzea_

PDB Entry: 1hze

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

PDB Compounds: (A:) riboflavin synthase alpha chain

SCOPe Domain Sequences for d1hzea_:

Sequence; same for both SEQRES and ATOM records:

>d1hzea_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

Timeline for d1hzea_:

• d1hzea_ first appeared in SCOP 1.57
  
• d1hzea_ appears in SCOPe 2.07