Lineage for d1hzea_ (1hze A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60235Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
  6. 60236Protein Riboflavin synthase [63784] (1 species)
  7. 60237Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)
  8. 60244Domain d1hzea_: 1hze A: [61434]

Details for d1hzea_

PDB Entry: 1hze (more details)

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

SCOP Domain Sequences for d1hzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzea_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

SCOP Domain Coordinates for d1hzea_:

Click to download the PDB-style file with coordinates for d1hzea_.
(The format of our PDB-style files is described here.)

Timeline for d1hzea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hzeb_