SCOP 1.57: Domain d1hzeb_: 1hze B:

Lineage for d1hzeb_ (1hze B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)

6. Protein Riboflavin synthase [63784] (1 species)

7. Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)

8. Domain d1hzeb_: 1hze B: [61435]

Details for d1hzeb_

PDB Entry: 1hze

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

SCOP Domain Sequences for d1hzeb_:

Sequence; same for both SEQRES and ATOM records:

>d1hzeb_ b.43.4.3 (B:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

Timeline for d1hzeb_:

• d1hzeb_ is new in SCOP 1.57
  
• d1hzeb_ appears in SCOP 1.59
  
• d1hzeb_ appears in the current release, SCOPe 2.08