![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (3 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (17 PDB entries) |
![]() | Domain d1hyva_: 1hyv A: [61424] complexed with caf, cl, so4, tta; mutant |
PDB Entry: 1hyv (more details), 1.7 Å
SCOP Domain Sequences for d1hyva_:
Sequence, based on SEQRES records: (download)
>d1hyva_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnkkrkggiggysagerivdiiatdiqt
>d1hyva_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfih nkkrkggysagerivdiiatdiqt
Timeline for d1hyva_: