Lineage for d1hysd1 (1hys D:1-123)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451496Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
  8. 451508Domain d1hysd1: 1hys D:1-123 [61422]
    Other proteins in same PDB: d1hysa1, d1hysa2, d1hysb_, d1hysc1, d1hysc2, d1hysd2
    part of Fab 28 against HIV-1 RT

Details for d1hysd1

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysd1 b.1.1.1 (D:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1hysd1:

Click to download the PDB-style file with coordinates for d1hysd1.
(The format of our PDB-style files is described here.)

Timeline for d1hysd1: