Lineage for d1hysa2 (1hys A:1-429)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 518049Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 518050Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 518051Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (78 PDB entries)
  8. 518195Domain d1hysa2: 1hys A:1-429 [61418]
    Other proteins in same PDB: d1hysa1, d1hysc1, d1hysc2, d1hysd1, d1hysd2

Details for d1hysa2

PDB Entry: 1hys (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hysa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1hysa2:

Click to download the PDB-style file with coordinates for d1hysa2.
(The format of our PDB-style files is described here.)

Timeline for d1hysa2: