![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (8 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.7: BAG domain [63491] (1 family) ![]() |
![]() | Family a.7.7.1: BAG domain [63492] (2 proteins) this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain |
![]() | Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63494] (1 PDB entry) |
![]() | Domain d1hx1b_: 1hx1 B: [61350] Other proteins in same PDB: d1hx1a1, d1hx1a2 complexed with trs |
PDB Entry: 1hx1 (more details), 1.9 Å
SCOP Domain Sequences for d1hx1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hx1b_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens)} gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqe
Timeline for d1hx1b_: