SCOP 1.57: Domain d1hx1b_: 1hx1 B:

Lineage for d1hx1b_ (1hx1 B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (1 protein)
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63494] (1 PDB entry)

8. Domain d1hx1b_: 1hx1 B: [61350]
   Other proteins in same PDB: d1hx1a1, d1hx1a2

Details for d1hx1b_

PDB Entry: 1hx1, 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain

SCOP Domain Sequences for d1hx1b_:

Sequence; same for both SEQRES and ATOM records:

>d1hx1b_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens)}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicqe

Timeline for d1hx1b_:

• d1hx1b_ is new in SCOP 1.57
  
• d1hx1b_ appears in SCOP 1.59
  
• d1hx1b_ appears in the current release, SCOPe 2.08, called d1hx1b1