Lineage for d1hx1a1 (1hx1 A:5-188)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316626Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 316697Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 316698Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 316721Domain d1hx1a1: 1hx1 A:5-188 [61348]
    Other proteins in same PDB: d1hx1b_

Details for d1hx1a1

PDB Entry: 1hx1 (more details), 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain

SCOP Domain Sequences for d1hx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx1a1 c.55.1.1 (A:5-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

SCOP Domain Coordinates for d1hx1a1:

Click to download the PDB-style file with coordinates for d1hx1a1.
(The format of our PDB-style files is described here.)

Timeline for d1hx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hx1b_