Lineage for d1hu8c_ (1hu8 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552786Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 552787Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)
  6. 552788Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 552803Species Mouse (Mus musculus) [TaxId:10090] [63683] (1 PDB entry)
  8. 552806Domain d1hu8c_: 1hu8 C: [61271]
    complexed with zn; mutant

Details for d1hu8c_

PDB Entry: 1hu8 (more details), 2.7 Å

PDB Description: crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution

SCOP Domain Sequences for d1hu8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hu8c_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Mouse (Mus musculus)}
tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
rrteee

SCOP Domain Coordinates for d1hu8c_:

Click to download the PDB-style file with coordinates for d1hu8c_.
(The format of our PDB-style files is described here.)

Timeline for d1hu8c_: