PDB entry 1hu8

View 1hu8 on RCSB PDB site
Description: crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution
Deposited on 2001-01-04, released 2001-07-04
The last revision prior to the SCOP 1.71 freeze date was dated 2001-07-04, with a file datestamp of 2001-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1hu8a_
  • Chain 'B':
    Domains in SCOP 1.71: d1hu8b_
  • Chain 'C':
    Domains in SCOP 1.71: d1hu8c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hu8A (A:)
    tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
    iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
    ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
    rrteee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hu8B (B:)
    tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
    iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
    ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
    rrteee
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hu8C (C:)
    tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
    iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
    ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
    rrteee