![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins) |
![]() | Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [63683] (1 PDB entry) |
![]() | Domain d1hu8c_: 1hu8 C: [61271] complexed with zn; mutant |
PDB Entry: 1hu8 (more details), 2.7 Å
SCOP Domain Sequences for d1hu8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hu8c_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd rrteee
Timeline for d1hu8c_: